PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_05653.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 141aa    MW: 16249.4 Da    PI: 6.8079
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_05653.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.41.5e-132583563
                             CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                             ++ +r+++NRe+ArrsR RK++++  L ++v +L++ N +  ++++  + ++ +++s++
  Rsa1.0_05653.1_g00004.1 25 RKRKRMISNRESARRSRMRKQKQLGDLINEVTVLKSDNAKISDQVDAVTRKYVEMESKN 83
                             6789**********************************************999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-162185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.6682386IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.6E-122577No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-112578No hitNo description
PfamPF001705.2E-122583IPR004827Basic-leucine zipper domain
CDDcd147024.33E-162676No hitNo description
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MGSLQRQTSP DSDNDPRYAS VTDERKRKRM ISNRESARRS RMRKQKQLGD LINEVTVLKS  60
DNAKISDQVD AVTRKYVEME SKNDVLRAQA SELTERLRSL NFVLEMVEEI SGQALDIPEI  120
NPWQVSCPMQ PIRASADMFE F
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12445RKRKRMISNRESARRSRMRKQK
23744RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009116910.17e-93PREDICTED: ocs element-binding factor 1
SwissprotQ9LZP82e-86BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A078FDM62e-93A0A078FDM6_BRANA; BnaA09g39870D protein
STRINGBra007679.1-P2e-92(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30362763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.11e-87basic region/leucine zipper motif 53